VIP Peptide

Price range: £100.29 through £902.59

Feature Specification
Molecular Formula C147H237N43O43S
Molecular Weight 3326.8 g/mol
Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Purity Level 98%
Physical State White Lyophilized Powder
Storage Temperature -20°C (Long Term)
Receptor Affinity VPAC1 and VPAC2

 

SKU: N/A Category: Tags: , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,

VIP Peptide: The Essential Research Tool for Vasoactive Studies

In the sophisticated world of biochemical research, vasoactive intestinal peptide (VIP) stands as a cornerstone molecule for understanding systemic regulation. When researchers look to buy VIP Peptide online UK, they are seeking a high-purity compound capable of modulating complex physiological pathways. VIP is a 28-amino acid neuropeptide that functions as a potent vasodilator and immunomodulator, making it indispensable for studies involving the cardiovascular, digestive, and immune systems.

What is VIP Peptide?

VIP is a member of the secretin/glucagon hormone superfamily. Originally isolated from the intestinal tract, it has since been identified as a significant neurotransmitter and neuromodulator throughout the central and peripheral nervous systems. Its composition consists of a linear polypeptide chain that interacts with specific G protein-coupled receptors (VPAC1 and VPAC2). Because of its widespread distribution in the body, it plays a vital role in maintaining homeostatic balance.

Mechanism of Action

The primary mechanism of VIP peptide is its ability to induce smooth muscle relaxation. By stimulating the production of cyclic adenosine monophosphate (cAMP), VIP promotes the widening of blood vessels (vasodilation) and relaxes the smooth muscles of the gastrointestinal and respiratory tracts. Beyond its physical effects, VIP acts as a “cytokine-like” molecule in the immune system, helping to regulate inflammatory responses by inhibiting the production of pro-inflammatory cytokines while promoting anti-inflammatory activity.

Research Benefits and Potential

Researchers who buy VIP peptides online UK typically focus on several key areas of investigation:

  • Cardiovascular Health: Studying its role in blood pressure regulation and heart muscle protection.

  • Respiratory Research: Investigating VIP as a potential agent for modulating airway resistance.

  • Neuroprotection: Exploring how VIP helps maintain the integrity of the blood-brain barrier and protects neurons from oxidative stress.

  • Circadian Rhythm: Researching its influence on the “biological clock” within the suprachiasmatic nucleus (SCN).

Purity, Safety, and Longevity

At Research Peptide Shop, we understand that research integrity is built on product quality. Our VIP Peptide is synthesized using the highest standards of solid-phase peptide synthesis, ensuring a purity level of $\ge$ 98% as verified by HPLC and mass spectrometry analysis.

For maximum longevity and stability, the peptide is supplied in a lyophilized (freeze-dried) format. This allows for safe shipping and storage. Once received, the product should be kept in a temperature-controlled environment; lyophilized powder remains stable at -20°C for up to 24 months. Upon reconstitution with bacteriostatic water, it should be refrigerated and used within a short research window to ensure the molecular structure does not degrade.

Why Choose Our VIP Peptide?

When you decide to buy VIP Peptide online UK through our platform, you are choosing a partner dedicated to the advancement of science. We provide detailed certificates of analysis (COA) to guarantee that the chemical specs meet your laboratory’s requirements. Our focus on customer satisfaction ensures that every order is handled with professional care, utilizing discreet packaging and reliable logistics to maintain the cold chain where necessary.

10mg

1 Vial, 10 Vial -10%, 4 Vial -5%

Shopping Cart